PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.2690s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 278aa    MW: 31786.3 Da    PI: 10.5887
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.2690s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.63.3e-29218268252
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+
  Araha.2690s0004.1.p 218 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQR 268
                          9*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.09E-14215269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-26216268IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-21218268IPR006447Myb domain, plants
PfamPF002493.0E-6219267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRS TTDQEDHEEL DLGFWRRALD SRTSSLVSNS  60
SSKTINHPCQ DLSLSNNSHH HQQQQQHHHH HPQLLPNCNG SNILTSFQFP TQQQQQHLQG  120
FLAHDLNTHL RPIRGIPLYH NPPPHHHHHH RPPPQCFPFD PSALIPSSSS SSPALTGNNN  180
SFNTSSVSNP NYHNHHHQTL NRARFMPRFP AKRSMRAPRM RWTTTLHARF VHAVELLGGH  240
ERATPKSVLE LMDVKDLTLA HVKSHLQRST FAWEANR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934910.0AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564392.11e-137probable transcription factor KAN2
SwissprotQ9C6161e-139KAN2_ARATH; Probable transcription factor KAN2
TrEMBLD7KHH91e-132D7KHH9_ARALL; Putative uncharacterized protein
STRINGAT1G32240.11e-136(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-106G2-like family protein